Protein Info for SO3485 in Shewanella oneidensis MR-1

Annotation: drug resistance transporter, Bcr/CflA family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 330 to 354 (25 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 7 to 374 (368 residues), 214 bits, see alignment E=2.3e-67 PF07690: MFS_1" amino acids 14 to 347 (334 residues), 142.5 bits, see alignment E=8.3e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3485)

Predicted SEED Role

"Multidrug resistance protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBM5 at UniProt or InterPro

Protein Sequence (382 amino acids)

>SO3485 drug resistance transporter, Bcr/CflA family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNIKPPLWLAVLLMMFPQIMETIYSPALPDIAEHFAVPISAAAQTLSVYFVAFAIGVFCW
GRLADVIGRRKAMLAGLVCYAIGSAFALLVSDFSLLLMARVLSAFGAAVGSVITQTMMRD
SYSGEELAKVFSVMGMSFGISPVIGLLLGSVLSAFWGYQGVFVVLMSSAIVLLFLSVKSL
PETKPAHTQTIAIGELAIKMLSDRGIIKNTLLVAAFNLMWFSYFSLAPFMFEAQGLSTLI
FGMSGLLLGFGAFLGSYFNQVLLGRCCTSPRLIRLASSIALVGGVGIWLLQSTFIGLNNV
YFLAPMLLIVIAYGIAIPNILSSALAGYRTYAGSAGALFGLFYYILLGAGLGVVGLINHL
GGVITLAALFCTVLSMSRARGE