Protein Info for SO3433 in Shewanella oneidensis MR-1

Name: nlpD
Annotation: lipoprotein NlpD (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01476: LysM" amino acids 49 to 91 (43 residues), 47.5 bits, see alignment 1.4e-16 PF01551: Peptidase_M23" amino acids 197 to 291 (95 residues), 102.1 bits, see alignment E=1.6e-33

Best Hits

KEGG orthology group: K06194, lipoprotein NlpD (inferred from 100% identity to son:SO_3433)

Predicted SEED Role

"Lipoprotein NlpD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBR7 at UniProt or InterPro

Protein Sequence (298 amino acids)

>SO3433 lipoprotein NlpD (NCBI ptt file) (Shewanella oneidensis MR-1)
MLNVGLLLNLSLLLLLAGCSFQASRPAPVESLSKHHSKQNKGHIKGESYKVKKGDTLYSI
SWAVGKDYAEIAKINQLDKSFTIYPGQVLYLTYDHSQNSKASTILGGINSANKGLYQLNS
SKKQYVSDDSAVEGLSSEPQKKTLDQKAKPAYSATSSQQRFNSSIVAPTSTLPDSVSQWQ
WPVRGKLIGTYSANEQGNKGIKIAGKRGDIIKAAADGRVVYAGSALRGYGNLVIIKHSDD
YLSAYAHADQILVDEKQHVLAGQTIAKMGSTGTNQVMLRFEIRYHGQSVNPLNYLPKQ