Protein Info for SO3341 in Shewanella oneidensis MR-1

Annotation: antioxidant, AhpC/TSA family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00578: AhpC-TSA" amino acids 49 to 170 (122 residues), 78.7 bits, see alignment E=3.7e-26 PF08534: Redoxin" amino acids 49 to 187 (139 residues), 83.6 bits, see alignment E=1.3e-27

Best Hits

Swiss-Prot: 45% identical to TPX_OCEIH: Thiol peroxidase (tpx) from Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)

KEGG orthology group: K11065, thiol peroxidase, atypical 2-Cys peroxiredoxin [EC: 1.11.1.15] (inferred from 100% identity to son:SO_3341)

Predicted SEED Role

"Thiol peroxidase, Tpx-type (EC 1.11.1.15)" in subsystem Thioredoxin-disulfide reductase (EC 1.11.1.15)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EC04 at UniProt or InterPro

Protein Sequence (197 amino acids)

>SO3341 antioxidant, AhpC/TSA family (NCBI ptt file) (Shewanella oneidensis MR-1)
MPKYVSFLAAGCVFSLMLLSPMAIANDKSQVMMGEKTVTLEGKLPKLEQMAPRFKVVDDK
FNPINLTDFKGKTILISAVPSLDTGVCALQTKRFNSEVGHFSDNVVMLTISTDLPFAQKR
FCKVENVENIKVLSDSVWRDFGEKYGLLIEDYGLLARAIFIIDAEGKLKYQELVPNITEH
PNYDAALEALKTIQAQQ