Protein Info for SO3291 in Shewanella oneidensis MR-1

Annotation: cytidine/deoxycytidylate deaminase family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF00383: dCMP_cyt_deam_1" amino acids 32 to 131 (100 residues), 108.2 bits, see alignment E=1.8e-35 PF14437: MafB19-deam" amino acids 34 to 179 (146 residues), 132.6 bits, see alignment E=9.9e-43

Best Hits

Swiss-Prot: 60% identical to TADA_SALTI: tRNA-specific adenosine deaminase (tadA) from Salmonella typhi

KEGG orthology group: K11991, tRNA-specific adenosine deaminase [EC: 3.5.4.-] (inferred from 100% identity to son:SO_3291)

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.-

Use Curated BLAST to search for 3.5.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EC53 at UniProt or InterPro

Protein Sequence (194 amino acids)

>SO3291 cytidine/deoxycytidylate deaminase family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MEQTKPDLKNQDANKLEKDVSTVEHSNVDQSKVDEHWMRVAMAMAEKAEAEGEVPVGAVL
VKDGLQIATGYNLSISQHDPCAHAEILCLRAAGQTVENYRLLDATLYVTLEPCAMCAGAM
VHSRIARVVFGARDEKTGAAGTVLNLLQHPAFNHQVEVTSGVLAQDCADQLSRFFKRRRE
EKKVLKQAQKVQQG