Protein Info for SO3220 in Shewanella oneidensis MR-1

Name: fliN
Annotation: flagellar motor switch protein FliN (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 PF28396: SepQ_C" amino acids 16 to 111 (96 residues), 31.5 bits, see alignment E=1.8e-11 TIGR02480: flagellar motor switch protein FliN" amino acids 42 to 116 (75 residues), 110.3 bits, see alignment E=1.6e-36 PF01052: FliMN_C" amino acids 44 to 114 (71 residues), 86.2 bits, see alignment E=1.1e-28

Best Hits

KEGG orthology group: K02417, flagellar motor switch protein FliN/FliY (inferred from 100% identity to son:SO_3220)

Predicted SEED Role

"Flagellar motor switch protein FliN" in subsystem Bacterial Chemotaxis or Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECC3 at UniProt or InterPro

Protein Sequence (124 amino acids)

>SO3220 flagellar motor switch protein FliN (NCBI ptt file) (Shewanella oneidensis MR-1)
MSTDDDWAAAMAEQALEEANAVGLDELVDDSQPISKAEAAKLDTILDIPVTISMEVGRSF
ISIRNLLQLNQGSVVELDRVAGEPLDVMVNGTLIAHGEVVVVNDKFGIRLTDVISQTERI
KKLK