Protein Info for SO3211 in Shewanella oneidensis MR-1

Name: flhG
Annotation: flagellar biosynthetic protein FlhG (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF06564: CBP_BcsQ" amino acids 11 to 153 (143 residues), 30.5 bits, see alignment E=9.1e-11 PF10609: ParA" amino acids 11 to 251 (241 residues), 83.5 bits, see alignment E=5.7e-27 PF13614: AAA_31" amino acids 11 to 167 (157 residues), 69.8 bits, see alignment E=1e-22 PF09140: MipZ" amino acids 12 to 188 (177 residues), 32.8 bits, see alignment E=1.6e-11 PF01656: CbiA" amino acids 13 to 229 (217 residues), 62.2 bits, see alignment E=1.7e-20 PF02374: ArsA_ATPase" amino acids 15 to 48 (34 residues), 34.5 bits, see alignment 4.7e-12 PF00142: Fer4_NifH" amino acids 17 to 254 (238 residues), 52.4 bits, see alignment E=2e-17

Best Hits

KEGG orthology group: K04562, flagellar biosynthesis protein FlhG (inferred from 100% identity to son:SO_3211)

Predicted SEED Role

"Flagellar synthesis regulator FleN" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECD2 at UniProt or InterPro

Protein Sequence (283 amino acids)

>SO3211 flagellar biosynthetic protein FlhG (NCBI ptt file) (Shewanella oneidensis MR-1)
MMNQPYNEKVKVIAVTGGKGGVGKTSVSINTAVALAEKGKRVLVLDADLGLANVDVMLGI
RAERNLSHVLSGDAELDDIIVRGPKGIGIVPATSGTQGMVELSPAQHAGLIRAFSEMRTQ
FDILIVDTAAGISDMVLSFSRASQDVLVVVCDEPTSITDAYALIKILSREHGVFRFKIVA
NMVRSLREGMELFAKLSKVTDRFLDVALELVATIPFDENLRKSVRKQKLVVEAYPKSPSA
IAYHGLANKIMSWPVPQQPGGHLEFFVERLVHRPDFQEEKTSE