Protein Info for SO3192 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 PF05635: 23S_rRNA_IVP" amino acids 4 to 105 (102 residues), 105.4 bits, see alignment E=9.1e-35 TIGR02436: four helix bundle protein" amino acids 8 to 110 (103 residues), 105 bits, see alignment E=1.2e-34

Best Hits

KEGG orthology group: None (inferred from 97% identity to shm:Shewmr7_1383)

Predicted SEED Role

"23Sr RNA gene"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECF0 at UniProt or InterPro

Protein Sequence (117 amino acids)

>SO3192 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MRFEQLDVWKRASRLSCQIYQVTESVSNWGFKDQITRSGLSIPSNIAEGEERETLKDQIR
FLYYAKGSLGELVTQLYIGIEVGYLAKEPALLMVQEAKELAKILGAIIKQKQSKSKS