Protein Info for SO3190 in Shewanella oneidensis MR-1

Annotation: polysaccharide biosynthesis protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03446: NAD_binding_2
  • amino acids 9 to 130 (122 residues), 21.9 bits, E=3.1e-08
• PF03721: UDPG_MGDP_dh_N
  • amino acids 9 to 182 (174 residues), 114 bits, E=1.3e-36
• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 9 to 413 (405 residues), 398.1 bits, E=2.1e-123
• PF00984: UDPG_MGDP_dh
  • amino acids 204 to 292 (89 residues), 88.1 bits, E=7e-29
• PF03720: UDPG_MGDP_dh_C
  • amino acids 319 to 418 (100 residues), 84 bits, E=1.7e-27

Best Hits

Swiss-Prot: 65% identical to VIPA_SALTI: Vi polysaccharide biosynthesis protein VipA/TviB (vipA) from Salmonella typhi

KEGG orthology group: K02474, UDP-N-acetyl-D-galactosamine dehydrogenase [EC: 1.1.1.-] (inferred from 100% identity to son:SO_3190)

MetaCyc: 76% identical to UDP-N-acetylgalactosamine 6-dehydrogenase (Pseudomonas aeruginosa)
UDP-N-acetylglucosamine 6-dehydrogenase. [EC: 1.1.1.136]; 1.1.1.136 [EC: 1.1.1.136]

Predicted SEED Role

"UDP-glucose 6-dehydrogenase (EC 1.1.1.22)" (EC 1.1.1.22)

MetaCyc Pathways

• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-xylose biosynthesis (1/2 steps found)
• UDP-N-acetyl-α-D-galactosaminuronate biosynthesis (1/2 steps found)
• colanic acid building blocks biosynthesis (6/11 steps found)
• UDP-2,3-diacetamido-2,3-dideoxy-α-D-mannuronate biosynthesis (1/5 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (9/24 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Starch and sucrose metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.22

Use Curated BLAST to search for 1.1.1.- or 1.1.1.136 or 1.1.1.22

Sequence Analysis Tools

See Q8ECF2 at UniProt or InterPro

Protein Sequence (426 amino acids)

>SO3190 polysaccharide biosynthesis protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MMFDVVNAKIGIIGLGYVGLPLAVEFGKQRLTIGFDINQARINELSAGHDSTLECSDTEL
AEAKKLVYTTSLEALKECNVFIVTVPTPIDEHKQPDLTPLIKASETLGKVIKHGDVIIYE
STVYPGATEEECIPVVEQVSGLKFNQDFFAGYSPERINPGDKEHRVTNILKVTSGSTPEV
AEYVDQLYKSIIVAGTHKASSIKVAEAAKVIENTQRDVNIALINELSIIFNKLGIDTLEV
LEAAGTKWNFLPFRPGLVGGHCIGVDPYYLTHKAQSVGYHPEMILAGRRLNDGMGQYVVS
QLVKKMLKKRIHVEGANVLVMGLTFKENCPDLRNTKVVDIVRELKEYNINVDIVDPWCES
HEAEQEYGLTLCGQPKVNHYDAIIIAVSHNEFRAMGAEAIRALGKPEHVLYDLKYVLNKE
SVDMRL