Protein Info for SO3122 in Shewanella oneidensis MR-1

Annotation: sodium/dicarboxylate symporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 42 to 65 (24 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 209 to 210 (2 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 288 to 314 (27 residues), see Phobius details amino acids 324 to 351 (28 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details PF00375: SDF" amino acids 16 to 395 (380 residues), 221.7 bits, see alignment E=8.7e-70

Best Hits

Swiss-Prot: 100% identical to SSTT_SHEON: Serine/threonine transporter SstT (sstT) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K07862, serine/threonine transporter (inferred from 100% identity to son:SO_3122)

MetaCyc: 66% identical to serine/threonine:Na+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-22449; RXN0-4083

Predicted SEED Role

"Sodium/dicarboxylate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECL5 at UniProt or InterPro

Protein Sequence (408 amino acids)

>SO3122 sodium/dicarboxylate symporter (NCBI ptt file) (Shewanella oneidensis MR-1)
MKQESSFLAKLANGSLVLQILVGIIAGVALASFSHEWAKQVAFLGSLFVGALKAIAPILV
FILVASSIANQKKNTQTNMRPIVVLYLLGTFAAALTAVILSMMFPTTLVLAAGVEGTSPP
QGISEVISTLLFKLVDNPVNALMTGNYIGILAWGVGLGLALHHSSDSTKQVFADVSHGIS
QMVHFIIRLAPIGIFGLVAATFAETGFAAIAGYAQLLAVLLGAMAFIALIINPLIVYVKI
KRNPYPLVIRCLRESGMTAFFTRSSAANIPVNMALCEKLKLHEDTYAVSIPLGATINMGG
AAITITVLTLAAAHTLGIQVDLLTALLLSVVAAISACGASGVAGGSLLLIPLACSLFGIS
NDVAMQVVAVGFIIGVIQDAAETALNSSTDVIFTAAACEAAENKAKLG