Protein Info for SO3063 in Shewanella oneidensis MR-1

Annotation: sodium:alanine symporter family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 231 to 256 (26 residues), see Phobius details amino acids 294 to 317 (24 residues), see Phobius details amino acids 324 to 341 (18 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 387 to 408 (22 residues), see Phobius details amino acids 414 to 440 (27 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 13 to 447 (435 residues), 486.9 bits, see alignment E=2.5e-150 PF01235: Na_Ala_symp" amino acids 49 to 459 (411 residues), 531.9 bits, see alignment E=6.1e-164

Best Hits

Swiss-Prot: 62% identical to YRBD_BACSU: Putative sodium/proton-dependent alanine carrier protein YrbD (yrbD) from Bacillus subtilis (strain 168)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 100% identity to son:SO_3063)

Predicted SEED Role

"sodium/alanine symporter family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECR9 at UniProt or InterPro

Protein Sequence (495 amino acids)

>SO3063 sodium:alanine symporter family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNEIVNAVNNIVWSPALVYLCLGVGLFFSLRSRFLQLRHLPEMIRLMFDGKSTDAGVSSF
QALAMTLAGRVGTGNIAGVATAITFGGPGALFWMWMVAFLGASSAFVESTLGQVYKEKIN
GEYRGGPAFYIEKGLGMKWYAWTFAIATIFACGVLLPGVQANSIGASLKTAFDIDPNVTA
AVLAMLLGFIIFGGVKRIANFATLVVPFMALGYIIVACVIIALNIDQLPGILWLIIKSAF
GFDAGFGAILGLAIMWGVKRGVYSNEAGQGTGPHASSAAAVTHPAKQGLVQAFSVYIDTL
FVCSATGFMLLITGLYNVQGPDGAALYTGIAGVAAGSGYVQTAMESMMPGFGNMFVAIAL
FFFAFTTIVAYYYIAETNIAYINRKVNRPWLTVMLKVIIMASTVYGTVKTADLAWGMGDI
GVGIMAWLNIIAIILLQKVAFTCLKDYESQQKQGIEPQFDPEKLGIPHADYWVERKNAQD
EPMSIRHSIESKKRV