Protein Info for SO3015 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF02616: SMC_ScpA" amino acids 49 to 260 (212 residues), 106.9 bits, see alignment E=8.2e-35

Best Hits

Swiss-Prot: 53% identical to SCPA_COXBU: Segregation and condensation protein A (scpA) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K05896, segregation and condensation protein A (inferred from 100% identity to son:SO_3015)

Predicted SEED Role

"Segregation and condensation protein A" in subsystem Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECV8 at UniProt or InterPro

Protein Sequence (262 amino acids)

>SO3015 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MQGTQQSLPLAVVRGQAMTEMPQDLFIPPEALEVFLESFEGPLDLLLYLIRKQKLDVVDL
PISQITAQYLEYIAMLTQARIELASDYLVMAATLAEIKSRLLLPRMVAEDEVEEDPRAQL
IRQLKAYEVIKEASQKIDDLPRLERDVFQATAAPSPNIKPLVIPPDVSLFEIARAFGDVL
KRIDAYEDHHVKREQLSTRERMSQILAMLNSEDFTPFERLFSVEEGRAGVVVTFLALMEL
VKELLVELYQTEPFSTIYVKAY