Protein Info for SO2916 in Shewanella oneidensis MR-1

Name: pta
Annotation: phosphate acetyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 717 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13500: AAA_26" amino acids 3 to 229 (227 residues), 123.9 bits, see alignment E=1.1e-39 PF07085: DRTGG" amino acids 233 to 344 (112 residues), 98.8 bits, see alignment E=2.3e-32 PF01515: PTA_PTB" amino acids 391 to 706 (316 residues), 417.3 bits, see alignment E=7.4e-129 TIGR00651: phosphate acetyltransferase" amino acids 406 to 706 (301 residues), 440.5 bits, see alignment E=1.8e-136

Best Hits

Swiss-Prot: 62% identical to PTA_HAEIN: Phosphate acetyltransferase (pta) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K13788, phosphate acetyltransferase [EC: 2.3.1.8] (inferred from 100% identity to son:SO_2916)

Predicted SEED Role

"Phosphate acetyltransferase (EC 2.3.1.8)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or MLST or Propanediol utilization or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.3.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ED54 at UniProt or InterPro

Protein Sequence (717 amino acids)

>SO2916 phosphate acetyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSRNIMLIPIGTGVGLTSLSLGMVRALERHGVKVQFFKPISQLRPNDNGPERSTTILSKS
PTVNPLEPFDMAHAEALIRADQTDVLMEQIIARAAECASNTETLIVEGLVPTRNHPFADD
VNYAIAKAMDADVIFIATPGSDTPTGLMNRLEIAYNSWGGKNNKRLIGAVINKIGAPVDD
EGRARPDLSEVFDHQGVQRSDASIMFQLPGKSPLRILGSVPYNLDLVAPRASDLAKHLRA
RILNAGEMNIRRLRKVTFCARSLPNMVNHIKTDSLLVTSGDRSDVIVSACLAAMNGVKIG
ALLLTGSYEPEPEILKLCEQAFETGLPVFLIDTNTWQTSLNIQRFDHEVPVDDAVRIDLV
QEYVASHIDQTWIESVTKNSPREHRLSPPAFRYKLTELARAAHKTVVLPEGDEPRTIKAA
AICAERGIARCVLLGKKDEILRIAAQQDVVLGEGVVIVDPDEVRARYVEPMLELRRSKGL
TEVVAKEQLEDNMVLGTMMLAQDEVDGIVSGAVNTTANTIRPPLQLIKTAPGSSLVSSIF
FMLMPDQVLVYGDCAINPDPNAEQLADIAIQSAESAKAFGIEPRVAMISYSTGNSGTGSD
VDKVREATRIAKEKRPDLVIDGPLQYDAAVMPNVARSKAPNSPVAGQATVFVFPDLNTGN
TTYKAVQRSADLISIGPMLQGMRKPVNDLSRGALVDDIVYTIALTAIQASQNDAKKS