Protein Info for SO2889 in Shewanella oneidensis MR-1

Annotation: sensory box histidine kinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 869 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 350 to 359 (10 residues), see Phobius details amino acids 386 to 405 (20 residues), see Phobius details PF02743: dCache_1" amino acids 46 to 263 (218 residues), 46.5 bits, see alignment E=1e-15 PF22673: MCP-like_PDC_1" amino acids 112 to 219 (108 residues), 40.8 bits, see alignment E=8.2e-14 TIGR00229: PAS domain S-box protein" amino acids 485 to 607 (123 residues), 37.2 bits, see alignment E=1.5e-13 PF13188: PAS_8" amino acids 486 to 538 (53 residues), 22 bits, see alignment 3.7e-08 PF00989: PAS" amino acids 486 to 585 (100 residues), 26.7 bits, see alignment E=1.4e-09 PF08448: PAS_4" amino acids 493 to 593 (101 residues), 43.5 bits, see alignment E=1e-14 PF02518: HATPase_c" amino acids 768 to 867 (100 residues), 34.6 bits, see alignment E=6.8e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2889)

Predicted SEED Role

"Sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ED77 at UniProt or InterPro

Protein Sequence (869 amino acids)

>SO2889 sensory box histidine kinase (NCBI ptt file) (Shewanella oneidensis MR-1)
MDKRPNIEAQAPLTQWQKSLPFKLTLIQLLIASILIFSTAWVILNIQTQQINEQQTLLNQ
NHGQIIIAKLQEMTSQVENQVNAISQIAMLYRHEPEQLSKSIPELLSIESQKDIISGGGI
WPEPGAFNRQKFRDSLFWSHNIHGELVAIDSYNDDNFPSYHTEEWYRPTRFFPAGKVFWS
KSYVDLTTHEPMVTASSAMWMEHQFIGAATTDISLEKLNQLLRNAMLNVSGYVMALDHQN
QILAFPNRDNTLQSHSDTTHNLISFDAFAQTEQALTPIASALHLADRTFIEQAIAERVFT
QEQMENLTRLSKDSERDMLSAIVNDNAKNHFSTPKRIALVSLAMDPILKGPSLVSVFLMP
HTYWKILVVTPVAPLEDTAKKLIEKVGLSLVLIQMFGLILLFILQHKLIMAPIMEMVKAL
KRNDSASIELKAKERHDEVGLLAKTFLSRTQQLEIAMSSLDASNLALEQQLLSQQHFQQE
LNRHKEQLRSLLDYSSTIIYIKDLNGRYTLVNNKYCEVLGIERRKIIGAMDFELFQPPLA
ELYQQNDQRANNSHDALHFEEPIPTPRGEIIYHMTKFDIRDDEDNSIGVGAIGFNVDLKK
RQEKEQEKLLQYQLNQLKDQQHKTQLAQQEIAQLRAQLTDANDEINLQTQLNRNKQQSQK
LMQHFLSDVMNQMMQEQDRLLAQVCQHKDADQHTHVVQLMSQQAARLRQISQLFTVQQSE
IRPLHLAQFFQHLLSLLQPQLLKAQVKVSLSCDEQLVIDGDAWQYLQFFYRLLNNTLQHA
FKDHHQHRELLLQLKKQGHELQLLVKDNGVGLSASKLEQLRHEMQQKQCTGTLSSLNLWI
KDELKGELNIKSELNQGTRIECHWPLSKA