Protein Info for SO2879 in Shewanella oneidensis MR-1

Name: uraA
Annotation: uracil permease (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 23 (4 residues), see Phobius details amino acids 29 to 49 (21 residues), see Phobius details amino acids 56 to 73 (18 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 179 to 206 (28 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 325 to 347 (23 residues), see Phobius details amino acids 359 to 377 (19 residues), see Phobius details amino acids 383 to 401 (19 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 8 to 398 (391 residues), 376.9 bits, see alignment E=6.4e-117 PF00860: Xan_ur_permease" amino acids 9 to 374 (366 residues), 328.7 bits, see alignment E=2.1e-102

Best Hits

Swiss-Prot: 48% identical to PYRP_BACCL: Uracil permease (pyrP) from Bacillus caldolyticus

KEGG orthology group: K02824, uracil permease (inferred from 100% identity to son:SO_2879)

Predicted SEED Role

"Uracil permease" in subsystem De Novo Pyrimidine Synthesis or Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ED85 at UniProt or InterPro

Protein Sequence (412 amino acids)

>SO2879 uracil permease (NCBI ptt file) (Shewanella oneidensis MR-1)
MRRLAIPLQGAQMLFVAFGALVLMPLLTGLDTSVALFTAGIGTLLFQLITKRQVPIFLAS
SFAFIAPILYGVQTWGIPSTMGGIMAAGVVYVCLGALVKVRGTDFIHKLLPPVVVGPVII
IIGLGLAPVAVNMALGKSGDGSLALVPTNTALIISLVSLCTTIAVAIFAKGLLKVMPILA
GIIVGYGLSLAFGIVDFSVVTAANWIAIPKFVAPEFNWHAIAFMIPVAIAPAVEHIGDIL
AISNVTGKDFMKKPGLHRTLTGDGVATIAAAAFGGPPNTTYSEVTGAVTLTRNFDPRIMT
WTAITAITLAFVGKLGALMQTIPVPVMGGIMCLLFGSIAAVGLNTLIRNHVDLSEPRNLS
IVGVTLVFGIGGMAFGIGSFSLTGISLCGIVAITMNLLLPASKHHKQDVASH