Protein Info for SO2865 in Shewanella oneidensis MR-1
Annotation: L-lysine exporter, putative (NCBI ptt file)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 42% identical to ARGO_KLEP3: Arginine exporter protein ArgO (argO) from Klebsiella pneumoniae (strain 342)
KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 100% identity to son:SO_2865)MetaCyc: 40% identical to L-arginine exporter (Escherichia coli K-12 substr. MG1655)
RXN66-448; TRANS-RXN-325
Predicted SEED Role
"Transporter, LysE family"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8ED97 at UniProt or InterPro
Protein Sequence (206 amino acids)
>SO2865 L-lysine exporter, putative (NCBI ptt file) (Shewanella oneidensis MR-1) MQTAFIQGMGIGGSLIIAVGAQNAFVLKQGIKRAYPLPIALLCSIIDALMITAGVAGLGH IIETFPTIKHVASFGGAAFLIWYGANALKASFVTKGMEMDHAQNADTLRKAILTTLGISL LNPHLYLDTVVLLGSISTQFEDAHRPWFGAGAVLASFIWFFSLSFGARLLAPIFSRPAAW RYLDRFIWLTMWSIAAAIIWPYLAAI