Protein Info for SO2863 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details PF11143: DUF2919" amino acids 5 to 150 (146 residues), 179.3 bits, see alignment E=2.9e-57

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2863)

Predicted SEED Role

"FIG01056753: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ED99 at UniProt or InterPro

Protein Sequence (160 amino acids)

>SO2863 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNFSHITWLDDKGHIKPPIFLYVILAFLARGWCIFIASLTQANDRAELVRIFYPEKSDFL
LALAAGLGAVVLYFVVLAERRRSPQWLRPVFVRLKWGLWLLLLLDAGLLTQRLIHGQFLF
HWSLALDALVLFWSCLYVYKSKRLRYYLADWPKEAKTEIK