Protein Info for SO2757 in Shewanella oneidensis MR-1

Annotation: membrane protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 57 to 79 (23 residues), see Phobius details amino acids 98 to 115 (18 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 331 to 350 (20 residues), see Phobius details amino acids 361 to 386 (26 residues), see Phobius details amino acids 420 to 438 (19 residues), see Phobius details PF13726: Na_H_antiport_2" amino acids 2 to 87 (86 residues), 113.2 bits, see alignment E=1.1e-36 PF02447: GntP_permease" amino acids 3 to 214 (212 residues), 25.9 bits, see alignment E=8.6e-10 PF03553: Na_H_antiporter" amino acids 150 to 433 (284 residues), 245.9 bits, see alignment E=1.2e-76 PF06808: DctM" amino acids 195 to 389 (195 residues), 26.5 bits, see alignment E=5.7e-10

Best Hits

Swiss-Prot: 68% identical to Y2115_VIBPA: Uncharacterized membrane protein VP2115 (VP2115) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K07084, (no description) (inferred from 100% identity to son:SO_2757)

Predicted SEED Role

"Histidine permease YuiF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDJ1 at UniProt or InterPro

Protein Sequence (439 amino acids)

>SO2757 membrane protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MNAVVIAVCLMLALSLARVNVVVALTISALVAGLVGGMDLHRTIDAFNTGLGGGAQIALS
YALLGAFAVALSHSGLTTLISNSIIKSLGREPNATNTNWVRWLLLLSLLAMSMASQNILP
IHIAFIPILVPPLLHVMTKLNIDRRLVACVLTFGLVTTYMILPVGFGGIFLNDILLSNLT
SNGLVAVRDQIPPAMLIPAAGMVVGLLIAVFVSYRKPRVYDETKVLSAEPEEKLNKRNIV
IAALAILATLFVQLETDSMIFGALVGFMIFSFSGALKHVADQDIFTQGVRMMANIGFIMI
SAAGFAAVVKETGEVGTLVSSLSSLIGDNKALAAFLMLVVGLLITMGIGSSFSTIPIIAT
IYVPLALSFGFSVPATIALVGTAAALGDAGSPASDSTLGPTSGLNADGQHDHIRDSVIPT
FIHYNIPLLVFGWIAAMVL