Protein Info for SO2755 in Shewanella oneidensis MR-1

Name: rnt
Annotation: ribonuclease T (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 TIGR01298: ribonuclease T" amino acids 10 to 208 (199 residues), 330.3 bits, see alignment E=2.1e-103 PF00929: RNase_T" amino acids 20 to 194 (175 residues), 94.2 bits, see alignment E=1.4e-30

Best Hits

Swiss-Prot: 100% identical to RNT_SHEON: Ribonuclease T (rnt) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03683, ribonuclease T [EC: 3.1.13.-] (inferred from 100% identity to son:SO_2755)

MetaCyc: 70% identical to ribonuclease T (Escherichia coli K-12 substr. MG1655)
Ribonuclease D. [EC: 3.1.13.5]; 3.1.13.5 [EC: 3.1.13.5]; 3.1.13.- [EC: 3.1.13.5]

Predicted SEED Role

"Ribonuclease T (EC 3.1.13.-)" in subsystem tRNA processing (EC 3.1.13.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.13.5

Use Curated BLAST to search for 3.1.13.- or 3.1.13.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDJ2 at UniProt or InterPro

Protein Sequence (222 amino acids)

>SO2755 ribonuclease T (NCBI ptt file) (Shewanella oneidensis MR-1)
MSDICDANKLKHRFRGYFPVVIDVETAGFNSQTDALLEIAVTLLKMDDEGLLGIDKTLHF
HIEPFEGANLEPEALAFNGIDPTNPLRGAVSEKDAFLEIFKAVKKAQKASDCHRSIIVAH
NAAFDHGFVSKAIERCDLKRSPFHPFATFDTATLAGLAIGHTVLAKACIMAGIPFDNKEA
HSALYDTERTAELFCYIVNRWKTLGGWPLLATSESEDMDSEE