Protein Info for SO2750 in Shewanella oneidensis MR-1

Name: tolR
Annotation: tolr protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details PF02472: ExbD" amino acids 10 to 138 (129 residues), 102.3 bits, see alignment E=1.1e-33 TIGR02801: protein TolR" amino acids 13 to 139 (127 residues), 151.3 bits, see alignment E=1.1e-48

Best Hits

Swiss-Prot: 49% identical to TOLR_PSEAE: Tol-Pal system protein TolR (tolR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03560, biopolymer transport protein TolR (inferred from 98% identity to shn:Shewana3_2533)

MetaCyc: 41% identical to Ton complex subunit ExbD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Tol biopolymer transport system, TolR protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDJ6 at UniProt or InterPro

Protein Sequence (144 amino acids)

>SO2750 tolr protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MQVGYQRKRRRPVAEINVVPYIDVMLVLLIIFMVTAPIVTQGVKVELPQGAAEVLPADSK
PPVVASIDADGAYFLNQGGSNNEEMELEELATAVAAIMVTEPQRPVVVKADRTIPYDNVI
QLMVTLQQAGVPSVGLMTDSPKEK