Protein Info for SO2746 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 33 to 105 (73 residues), 89.2 bits, see alignment E=5.1e-29 TIGR02795: tol-pal system protein YbgF" amino acids 129 to 245 (117 residues), 136.5 bits, see alignment E=3.2e-44 PF13432: TPR_16" amino acids 136 to 197 (62 residues), 35.1 bits, see alignment E=5e-12 PF13174: TPR_6" amino acids 138 to 161 (24 residues), 18.1 bits, see alignment (E = 1.2e-06) amino acids 167 to 198 (32 residues), 15.7 bits, see alignment 6.7e-06 amino acids 203 to 235 (33 residues), 25.8 bits, see alignment 4.2e-09 PF14559: TPR_19" amino acids 139 to 197 (59 residues), 26.1 bits, see alignment E=3e-09 PF13181: TPR_8" amino acids 165 to 193 (29 residues), 14 bits, see alignment (E = 1.7e-05) amino acids 203 to 230 (28 residues), 14.4 bits, see alignment (E = 1.3e-05)

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2746)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDK0 at UniProt or InterPro

Protein Sequence (250 amino acids)

>SO2746 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKRAVLITAMFFGAGAAVAAPAPVEDLAGGSGDDRLARLERIVKSRQQSEIDMQRRLDTL
QQEVLDLRGLTEQQNYQIEQMQQRQRQLYDEIANLSSKATATPAASVPATPAAVAATANA
AASSLSETASYESAVNLVLKERKYDDAIPAFRAFIKQYPDSVYAANANYWLGQLLFNKSE
FAEAKQVFNTVVTRFSDSNKRGDSLVKLGMIAEKTGDKAGATQYYQQVVKDYANSAAARI
AQQQLAAIKA