Protein Info for SO2744 in Shewanella oneidensis MR-1

Updated annotation (from data): DNA damage response helicase (yejH or radD)
Rationale: Conserved and specific phenotype: important for resisting cisplatin. Also important for resisting ionizing radiation and UV radiation in E. coli (PMID:25425430)
Original annotation: helicase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 PF04851: ResIII" amino acids 10 to 161 (152 residues), 88 bits, see alignment E=1.4e-28 PF00270: DEAD" amino acids 13 to 159 (147 residues), 43.9 bits, see alignment E=4.5e-15 PF18766: SWI2_SNF2" amino acids 14 to 160 (147 residues), 29.2 bits, see alignment E=1.4e-10 PF00271: Helicase_C" amino acids 247 to 353 (107 residues), 64.5 bits, see alignment E=2.1e-21

Best Hits

Swiss-Prot: 55% identical to RADD_ECOLI: Putative DNA repair helicase RadD (radD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to son:SO_2744)

MetaCyc: 55% identical to putative DNA repair helicase RadD (Escherichia coli K-12 substr. MG1655)
Nucleoside-triphosphatase. [EC: 3.6.1.15, 3.6.1.5]

Predicted SEED Role

"ATP-dependent RNA helicase YejH"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.15

Use Curated BLAST to search for 3.6.1.15 or 3.6.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDK2 at UniProt or InterPro

Protein Sequence (590 amino acids)

>SO2744 DNA damage response helicase (yejH or radD) (Shewanella oneidensis MR-1)
MSVNSSPSVILRDYQQQAVDAAIVHFKKSTDSAVLVLPTGAGKSIVIAELARIARGRVLV
LTHVKELVAQNAQKVGLLTTEASIYSAGLNKKSSVGKTVVASIQSAARALGQFNEPFSLV
IIDECHRVSLEKTSQYQQLLSHLQQRNPQLKLLGLTATPYRLGTGWIYKRHYHGKVGSPE
LGIFEQCIFELPIRPLIKQGYLTAPTLFDGLSAQYDFSQIKANKNGEYPEAQVNDLLNHA
GRATTAIVKQLIELSHHRQGIIIFAATVRHAEEIVSQLNKEHREQTAIVTAQTPDNERDE
LIERFKARELKFLVNVAVLTTGFDAPHVDLIAILRPTASVSLFQQMIGRGLRICEGKKDC
LVIDYAANGYDLYFPEVGQAKPNSKSVPVQVHCPVCQFANIFWGLTDDDGDIIEHFGRRC
QGIVEHHGKKQQCDFRFRAKSCPDCGQENDIAARICQHCQSTLIDPDKRLKQVLNKQHHH
LFRCQHMTLMDDAGDLKVQYLDIDGNEFNRHFKLQTPAQWRALYALFIFPHSRTPGLKPK
QYKQVSELIADSATFKMPDLLLLKKHKKGWDLLESYFDYQGRYQTENKHI