Protein Info for SO2741 in Shewanella oneidensis MR-1

Name: bioA
Annotation: adenosylmethionine--8-amino-7-oxononanoate aminotransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 TIGR00508: adenosylmethionine-8-amino-7-oxononanoate transaminase" amino acids 14 to 428 (415 residues), 591.2 bits, see alignment E=4.4e-182 PF00202: Aminotran_3" amino acids 28 to 427 (400 residues), 407.6 bits, see alignment E=2.5e-126

Best Hits

Swiss-Prot: 59% identical to BIOA_ESCVU: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase (bioA) from Escherichia vulneris

KEGG orthology group: K00833, adenosylmethionine-8-amino-7-oxononanoate aminotransferase [EC: 2.6.1.62] (inferred from 100% identity to son:SO_2741)

MetaCyc: 59% identical to adenosylmethionine-8-amino-7-oxononanoate aminotransferase (Escherichia coli K-12 substr. MG1655)
Adenosylmethionine--8-amino-7-oxononanoate transaminase. [EC: 2.6.1.62]

Predicted SEED Role

"Adenosylmethionine-8-amino-7-oxononanoate aminotransferase (EC 2.6.1.62)" in subsystem Biotin biosynthesis (EC 2.6.1.62)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.62

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDK5 at UniProt or InterPro

Protein Sequence (461 amino acids)

>SO2741 adenosylmethionine--8-amino-7-oxononanoate aminotransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MRNLLDFDFDSAHIWHPYTSMTRALPVFGVHSAQGCELELVDGRKLIDGTSSWWACVHGY
GHPAILTAMEQQLHQLSHVMFGGITHEPAIELCKKLLAMTCEPLTKVFLCDSGSIAVEVA
IKMALQYWQGQDLPLAQKAQKQRILTVKKGYHGDTFAAMSVCDPEGGMHTMFGEAVIKQC
FVDAPQTPFGESLHQDDLAPMQRILREQHQDIAAVIIEPIMQGAGGMRFYSSEYLRGLRA
LCDEYNVLLILDEIATGFGRTGKLFAYEHTDITPDILCLGKALTGGYISLAATLCTDNVA
QGISQSPAGVFMHGPTFMGNPLACAAACASLDLINQQEWPAQVAAIEQQMQRELADAIDI
PSVKAVRVLGAVGVLEMHQAVNTAALQQQFVDLGVWVRPFANLIYIMPPYVISSAQLSQL
TQAMKQVAATITPPNITPPNTTPELASQGWHTDQNISISHG