Protein Info for SO2727 in Shewanella oneidensis MR-1

Annotation: cytochrome c3 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF14537: Cytochrom_c3_2" amino acids 33 to 105 (73 residues), 50.9 bits, see alignment E=8.9e-18

Best Hits

Swiss-Prot: 66% identical to CYC3_SHEFN: Tetraheme cytochrome c-type (cctA) from Shewanella frigidimarina (strain NCIMB 400)

KEGG orthology group: None (inferred from 100% identity to son:SO_2727)

Predicted SEED Role

"cytochrome c3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDL6 at UniProt or InterPro

Protein Sequence (116 amino acids)

>SO2727 cytochrome c3 (NCBI ptt file) (Shewanella oneidensis MR-1)
MSKKLLSVLFGASLAALALSPTAFAADQKLSDFHAESGGCESCHKDGTPSADGAFEFAQC
QSCHGKLSEMDAVHKPHDGNLVCADCHAVHDMNVGQKPTCESCHDDGRTSASVLKK