Protein Info for SO2685 in Shewanella oneidensis MR-1

Annotation: prophage MuSo2, major head subunit, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF10124: Mu-like_gpT" amino acids 8 to 296 (289 residues), 368.1 bits, see alignment E=3.4e-114

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2685)

Predicted SEED Role

"Phage major capsid protein" in subsystem Phage capsid proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDQ8 at UniProt or InterPro

Protein Sequence (299 amino acids)

>SO2685 prophage MuSo2, major head subunit, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MATEAQVLEALQATMSAAYTRGLSAAKPQWNMIATEVPSAGAANFYGWLKDLPGIVEWTG
ARQLANLGKHGYSIENKTFESSISISRDNVDDDQIGQYSVIAQNYGDQVAYFPDTLAYPL
LKAGFTTLCYDGQNFFDTDHPLATTPATTFSNVIGDPATDTGEPWFLIDDTKVLKPIVFQ
NRRPFVFKNMNPNEEYTWFNNKYAAGVDGRCNVGFSFPQLAIGSKAALTEANYAAAKKLL
LKMKKVDGTPIGTRATKLVVGPDNEAAAKKLISRMLIEGGDTNIYYNDVEIVVSPLVTA