Protein Info for SO2646 in Shewanella oneidensis MR-1

Name: aroH
Annotation: phospho-2-dehydro-3-deoxyheptonate aldolase, trp-sensitive (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 TIGR00034: 3-deoxy-7-phosphoheptulonate synthase" amino acids 6 to 349 (344 residues), 523.2 bits, see alignment E=1.1e-161 PF00793: DAHP_synth_1" amino acids 45 to 338 (294 residues), 305.6 bits, see alignment E=1.1e-95

Best Hits

Swiss-Prot: 64% identical to AROH_ECOL6: Phospho-2-dehydro-3-deoxyheptonate aldolase, Trp-sensitive (aroH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01626, 3-deoxy-7-phosphoheptulonate synthase [EC: 2.5.1.54] (inferred from 100% identity to son:SO_2646)

MetaCyc: 64% identical to 3-deoxy-7-phosphoheptulonate synthase, Trp-sensitive (Escherichia coli K-12 substr. MG1655)
3-deoxy-7-phosphoheptulonate synthase. [EC: 2.5.1.54]

Predicted SEED Role

"2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase I alpha (EC 2.5.1.54)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.54

Use Curated BLAST to search for 2.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDU7 at UniProt or InterPro

Protein Sequence (354 amino acids)

>SO2646 phospho-2-dehydro-3-deoxyheptonate aldolase, trp-sensitive (NCBI ptt file) (Shewanella oneidensis MR-1)
MTIKTDELRTSLLAKVISPAQLASEYPLTQDAADYLVQQRREVEAIIMGEDQRLLVIIGP
CSIHDTQAALDYARRLAVLHQELKDDLCILMRVYFEKPRTIVGWKGLISDPDLDGSFEPN
KGLRIARQLLQQITELKLPIATEFLDMVNGQYIADLITWGAIGARTTESQVHREMASALS
CPVGFKNGTDGNINIAVDAVRAAKVPHIFYSPDKDGAMSVYRTHGNPYGHIILRGGKKPN
YFEQDIEQARLKLESVNVTPRVVVDFSHGNSEKNHLKQLVVAENIMAQMRAGSTAIAGIM
AESFLQEGNQKVIEGQPLCYGQSITDACLHWADSEKLLRDLASASRDRRELLGK