Protein Info for SO2628 in Shewanella oneidensis MR-1

Name: cspD
Annotation: stress response protein CspD (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 68 TIGR02381: cold shock domain protein CspD" amino acids 1 to 66 (66 residues), 130.5 bits, see alignment E=8.5e-43 PF00313: CSD" amino acids 3 to 65 (63 residues), 98.1 bits, see alignment E=1.1e-32

Best Hits

Swiss-Prot: 78% identical to CSPD_SHIFL: Cold shock-like protein CspD (cspD) from Shigella flexneri

KEGG orthology group: K03704, cold shock protein (beta-ribbon, CspA family) (inferred from 94% identity to swd:Swoo_2701)

Predicted SEED Role

"Cold shock protein CspD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDW3 at UniProt or InterPro

Protein Sequence (68 amino acids)

>SO2628 stress response protein CspD (NCBI ptt file) (Shewanella oneidensis MR-1)
MASGTVKWFNNAKGFGFICPDQGGEDVFAHYSTIEMEGYRTLKAGQPVQFEVEQGPKGMH
ASAISPTK