Protein Info for SO2624 in Shewanella oneidensis MR-1

Annotation: hypothetical arginyl-tRNA:protein arginylyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF04376: ATE_N" amino acids 19 to 87 (69 residues), 78.8 bits, see alignment E=3e-26 PF04377: ATE_C" amino acids 107 to 227 (121 residues), 130.4 bits, see alignment E=5.8e-42

Best Hits

Swiss-Prot: 100% identical to BPT_SHEON: Aspartate/glutamate leucyltransferase (bpt) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00685, arginine-tRNA-protein transferase [EC: 2.3.2.8] (inferred from 100% identity to son:SO_2624)

MetaCyc: 44% identical to leucylD,E-transferase (Vibrio vulnificus CMCP6)
RXN-17898 [EC: 2.3.2.29]; 2.3.2.29 [EC: 2.3.2.29]

Predicted SEED Role

"Arginine-tRNA-protein transferase (EC 2.3.2.8)" in subsystem Protein degradation (EC 2.3.2.8)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.29 or 2.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDW7 at UniProt or InterPro

Protein Sequence (238 amino acids)

>SO2624 hypothetical arginyl-tRNA:protein arginylyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MNSNANNTPIAIGISQVFPCSYLDGQQEQLLVIQEETLDPILFERLLAIGFRRSGSAIYK
PRCPRCSACQPIRVPIQEFVPSKRQKRTLAHNRDLTWRITTEHTETQYALYEKYIRERHF
DGPMYPPSKAQYEQFLFCHWLPPTFIEVYDDNRLVAVAVTDTLPNSFSAIYSYFDPDEER
RSLGVLLILLQCRLAKLQGKAFLYLGYQIDANRKMSYKRLYRPYQILTHQGWEYSQVC