Protein Info for SO2616 in Shewanella oneidensis MR-1

Name: dcd
Annotation: deoxycytidine triphosphate deaminase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 2 to 190 (189 residues), 218.3 bits, E=3.1e-69
• PF22769: DCD
  • amino acids 3 to 163 (161 residues), 137.4 bits, E=4.5e-44
• PF06559: DCD_N
  • amino acids 4 to 140 (137 residues), 31.6 bits, E=1.5e-11

Best Hits

Swiss-Prot: 100% identical to DCD_SHEON: dCTP deaminase (dcd) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 100% identity to son:SO_2616)

MetaCyc: 74% identical to dCTP deaminase (Escherichia coli K-12 substr. MG1655)
dCTP deaminase. [EC: 3.5.4.13]

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (7/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

See Q8EDX5 at UniProt or InterPro

Protein Sequence (193 amino acids)

>SO2616 deoxycytidine triphosphate deaminase (NCBI ptt file) (Shewanella oneidensis MR-1)
MRLTDIEIEQALDNGTIVIEPRPNNDAISGVSVDVRLGGQFRVFKDHTAPFIDLSGPSGE
VQAALDRVMSEIIEIPDGEAFFLHPGELALAVTYESVTLPADIVGWLDGRSSLARLGLMV
HVTAHRIDPGWQGKIVLEFYNSGKLPLALRPRMTIGALNFERLSGPVARPYNKRKNAKYK
DQQDAVASRISQD