Protein Info for SO2609 in Shewanella oneidensis MR-1

Annotation: NOL1/NOP2/sun family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 PF17125: Methyltr_RsmF_N" amino acids 4 to 96 (93 residues), 86 bits, see alignment E=4.8e-28 TIGR00446: NOL1/NOP2/sun family putative RNA methylase" amino acids 37 to 304 (268 residues), 307.8 bits, see alignment E=2.8e-96 PF01189: Methyltr_RsmB-F" amino acids 112 to 302 (191 residues), 152.9 bits, see alignment E=2.3e-48 PF21150: YebU_pre-PUA_dom" amino acids 323 to 399 (77 residues), 67.3 bits, see alignment E=2.2e-22 PF13636: Methyltranf_PUA" amino acids 414 to 463 (50 residues), 59.1 bits, see alignment 8.9e-20

Best Hits

Swiss-Prot: 100% identical to RSMF_SHEON: Ribosomal RNA small subunit methyltransferase F (rsmF) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K11392, ribosomal RNA small subunit methyltransferase F [EC: 2.1.1.-] (inferred from 100% identity to son:SO_2609)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase F (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDY2 at UniProt or InterPro

Protein Sequence (474 amino acids)

>SO2609 NOL1/NOP2/sun family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MVQLNPNFINTISQELPAHLSMDEFIAACARPLRRSIRVNTLKISSEDFKRLMQPKGWTF
EPIPWCKDGFWISYDEEEQLGNALEHIQGLFYIQEASSMLPPTALFTPNADWQCVLDLAA
APGSKTTQMAALMNNQGLLVANEYSASRVKVLHANVLRMGASHCALTHFDGRVFGEYLYE
SFDAVLIDAPCGGEGTVRKDVDALKSWSLDEVIAISETQKALIESAFLALKPGGSLVYST
CTLNRHENQGVCEYLQQTYGNAVQFESLSQLFDGADKATTPEGFLHVWPQIYDSEGFFVA
KLTKTRSVPRLQLEPKLQKNFPFTEASPKQAKAIQAYFADDLGIELPDELIMVRDDEFWL
FPREFTDFIGKMRFQRIGLKLADHSKHGFKVRHEAVIALANTQANIIEINDEQAKEYLMG
RDIALDTATKAQGEIIVCYGGAPLGMAKHLGNKLKNNLPRDLVKDKVLLLPSQA