Protein Info for SO2606 in Shewanella oneidensis MR-1

Annotation: PqiB family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 869 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02470: MlaD" amino acids 32 to 123 (92 residues), 58 bits, see alignment E=4.8e-20 amino acids 147 to 218 (72 residues), 35.6 bits, see alignment E=4.4e-13 amino acids 265 to 353 (89 residues), 41.8 bits, see alignment E=5.4e-15 amino acids 381 to 447 (67 residues), 34.3 bits, see alignment 1.1e-12 amino acids 625 to 715 (91 residues), 42.2 bits, see alignment E=4e-15 amino acids 742 to 815 (74 residues), 35.6 bits, see alignment E=4.5e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2606)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EDY5 at UniProt or InterPro

Protein Sequence (869 amino acids)

>SO2606 PqiB family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKKKLFSPIWLLPIVALALGAWLGIKSIKESGVEIQIHFPSATGIDVGKTLVKYQGLTVG
KVKDIGIDDDLKGVNVKVMMDYRAKPFLNKETLFWLVTPKASITGVEGLDALFSGNYIAI
QPGKGNAATFFEAERQPPPMQIGSEGVMIELTADKLGSLDVGSPVFFRQIPVGSVVSYRL
DGNARVIISAFIQEQYARLVKKNSHFWNVSGVKVDASLAGIKVNTESLASILAGGVSFSS
DEKAAAAQNGDSFALYDSETSALGGVEVSLTMNDGNGIDKGTRIVYRGISVGSIQSKNLT
TTGVTAIAKFEPEYANLLTSDGRFWLEGADISLSGIKNPERLLTGSVINFLPGTNANTAL
PSSFALQSSAPDLLQAKKRLLTITSAENMGLTAGAEVRYKQLPIGQVLAVKLTKDLSAVE
YQLELQPEFASLVRSDSYFIPESALSVDASIEGVSVKTRDLATLTKGAVSLIPGSNNTPV
AANARLSLFSSVEEAKQFFERQQRLYFTLTSQDGADVSQGSPIYYKKMQIGRVESVNWQS
KTEDFAIKIAIDKQFQPLMQKPKVFWRNSALDVSASLAGIDVAVAPLQGALKGSISLGLL
ENPLADPTASLKLYENKQLALAQAQAIRLTLSASAKLAAKAAIRYQGHQVGEVTQVKLNA
DLNTLSATAYLYGEYADHFSSSDAEYHMVEAQISLAGIKAPETLITGPYIGVLPGKSKQK
ATQFQAKLVESSYANVAEDALKFTLEDSNLGSMKVGTPIFFRGLKVGQIDGYSLSSQGNS
VLMQAHIEPQYRHLVNKTSQFWDASGIKVDVGIFSGAQIEAGSLETLLAGGINVATKETT
QANNRLSQGAVITLQHKAQTEWQEWAPAQ