Protein Info for SO2590 in Shewanella oneidensis MR-1

Annotation: GTP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR03596: ribosome biogenesis GTP-binding protein YlqF" amino acids 3 to 272 (270 residues), 349.8 bits, see alignment E=5.4e-109 PF02421: FeoB_N" amino acids 117 to 169 (53 residues), 28.4 bits, see alignment 1.1e-10 PF01926: MMR_HSR1" amino acids 117 to 178 (62 residues), 55.6 bits, see alignment E=5.6e-19

Best Hits

Swiss-Prot: 48% identical to RBGA_GEOSW: Ribosome biogenesis GTPase A (rbgA) from Geobacillus sp. (strain WCH70)

KEGG orthology group: K14540, ribosome biogenesis GTPase A (inferred from 100% identity to son:SO_2590)

Predicted SEED Role

"50S ribosomal subunit maturation GTPase RbgA (B. subtilis YlqF)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EE00 at UniProt or InterPro

Protein Sequence (313 amino acids)

>SO2590 GTP-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MAIQWYPGHMHKARKEIEEAMPQVDLVIEVLDARIPYSSENPMVSKLRGDKPCIKLLNKS
DLADPEVTAQWIEYLEREQGVKATAITTLQPGMLKMLPDLCRKLVPSRDKTEKDIRTMIM
GIPNVGKSTIINTLAGRVIAKTGNEPAVTKTQQRINLRNGIVLSDTPGILWPKVDNEASS
YRLAVTGAIKDTAMEYEDVALFAAGYFLKAYPKEICERYNISELPKDDMALLEEIGRKRG
ALRPGGRIDLHKASELLLHEYRSGKIGLLSLETPAMAEIEKAEVERILAEKAAEKAAKLE
AEKLKRSGKRHND