Protein Info for SO2566 in Shewanella oneidensis MR-1

Name: asmA
Annotation: asmA protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details PF05170: AsmA" amino acids 5 to 324 (320 residues), 124 bits, see alignment E=8.2e-40 amino acids 200 to 508 (309 residues), 98.9 bits, see alignment E=3.3e-32

Best Hits

KEGG orthology group: K07289, AsmA protein (inferred from 100% identity to son:SO_2566)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EE24 at UniProt or InterPro

Protein Sequence (606 amino acids)

>SO2566 asmA protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTFIKWLLVILVTFVVAVTLYLTVFFDPNDFKPEVVNAVKKQTGRELVITEDLSWTFFPT
VGINLGGVSLSNPEGFTPKSMLEVHKAVAEVELMPLFSKQIEIVQLSLDGAKINLVTRKN
GSSSFDGLTGSTADKSSTPSEPSLSQAKLASIDVGGVSITNTQINLIDEAKGQTQTVTLK
QFTLGAFSLDKFAPIAYELTASLPDMTLSSKGEGQIKLSHDFNQLVIEKLDIATQVEGDA
IPHKKLTAEVSVNSQIALDKKQLSADINKFAVEDISATGKLAVHYAGKVPQINANLQLGD
IDLDALLPKSDTAEKQPIASTSSQAIEPDLTALNGLDARLTLAVKSIKVANLSTQNWLMD
LGIKNGVVDLKQLTADLYQGKLMLNAQVDARSKVASYQFDKQISAVQIQPLLKDAAELEI
LAGTANFSVKGKGKSLIPEQLKKNLLANGRFEITDGALYGVNIPQMIRSAQAKLKGDMSA
ETQEERKTDFSSLTGNFSLEHGVAANPDLAMSSPLIRLAGKGSANLLTETLDYRLTTSLV
NSLKGQGGSGKDALAGIDIPLAITGTFQKPEYALDTQALLNNQLKEETDKAKEKLKDSLL
KKLGGF