Protein Info for SO2553 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF04972: BON" amino acids 38 to 105 (68 residues), 54.7 bits, see alignment E=5e-19 amino acids 122 to 189 (68 residues), 58.6 bits, see alignment E=3e-20 amino acids 211 to 273 (63 residues), 60.4 bits, see alignment E=8.3e-21

Best Hits

KEGG orthology group: K04065, hyperosmotically inducible periplasmic protein (inferred from 100% identity to son:SO_2553)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EE37 at UniProt or InterPro

Protein Sequence (278 amino acids)

>SO2553 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNSSYRNFIFTSAILLILSALQPVSAADTAATATKAMDDVRQESQIATSYALSPYLRAND
LKVTVQKGKAVLTGKVDEKISKELAGEIALGVSGIKDVDNKIVVDANYIPKANSNSFGDK
FDDTNITAAIRSKLQWNKDVDDVVTEVITKSGRVTLNGIAENQNAKNVIHRLALNTRGVK
SVTNNLKVESSAINKEEKEKRKNETEIHNISDSWITAKIKSSFMYSNNINGSDIDVSTNN
GVVILTGKVNSGIEQSLAVETAQNIRGVKSVISKSLTF