Protein Info for SO2509 in Shewanella oneidensis MR-1

Annotation: iron-sulfur cluster-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 1 to 185 (185 residues), 286.6 bits, see alignment E=3.8e-90 PF04060: FeS" amino acids 44 to 75 (32 residues), 53.5 bits, see alignment 3.8e-18 PF14697: Fer4_21" amino acids 107 to 161 (55 residues), 70.3 bits, see alignment E=3e-23 PF13237: Fer4_10" amino acids 108 to 155 (48 residues), 30.2 bits, see alignment E=8.8e-11 PF00037: Fer4" amino acids 108 to 129 (22 residues), 29.5 bits, see alignment (E = 1.2e-10)

Best Hits

Swiss-Prot: 100% identical to RNFB_SHEON: Ion-translocating oxidoreductase complex subunit B (rnfB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 98% identity to shn:Shewana3_2169)

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EE80 at UniProt or InterPro

Protein Sequence (193 amino acids)

>SO2509 iron-sulfur cluster-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSTMLIAVILLTLLALFFGVLLGFAALKFKVEGNPIVDELEAILPQTQCGQCGYPGCRPY
AEAIANGDKVNKCPPGGTATMEKLASLMGVEPEPLNAEAQSQVKKVAYIREDECIGCTKC
IQACPVDAIIGAGKLMHTVLTADCTGCDLCVEPCPVDCIDMVPVTQNLKNWNWRLNAIPV
TLIQETPHEEKRG