Protein Info for SO2506 in Shewanella oneidensis MR-1

Name: uvrB
Annotation: excinuclease ABC, B subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 673 TIGR00631: excinuclease ABC subunit B" amino acids 6 to 667 (662 residues), 1078.2 bits, see alignment E=0 PF04851: ResIII" amino acids 17 to 88 (72 residues), 31.8 bits, see alignment E=4.6e-11 PF17757: UvrB_inter" amino acids 160 to 250 (91 residues), 116.2 bits, see alignment E=2e-37 PF27431: UvrB_3rd" amino acids 255 to 316 (62 residues), 92.3 bits, see alignment E=4.9e-30 PF00271: Helicase_C" amino acids 440 to 546 (107 residues), 72.7 bits, see alignment E=1e-23 PF12344: UvrB" amino acids 553 to 594 (42 residues), 72.8 bits, see alignment 5.6e-24 PF02151: UVR" amino acids 637 to 668 (32 residues), 35.7 bits, see alignment (E = 1.9e-12)

Best Hits

Swiss-Prot: 75% identical to UVRB_EDWI9: UvrABC system protein B (uvrB) from Edwardsiella ictaluri (strain 93-146)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 100% identity to son:SO_2506)

MetaCyc: 74% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EE83 at UniProt or InterPro

Protein Sequence (673 amino acids)

>SO2506 excinuclease ABC, B subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MSESVFQLESQFAPAGDQPTAIAKLVDGLESGLACQTLLGVTGSGKTFTIANVIAKLGRP
TIIMAPNKTLAAQLYGEMKEFFPNNAVEYFVSYYDYYQPEAYVPASNTFIEKDASVNAHI
EQMRLSATKALLERKDVVLIASVSAIYGLGDPDSYLKMLLHLRQGDTMGQRDILKRLSEL
QYTRNDIELQRGTFRVRGEVIDIFPADSDRYAIRVELFDDEIERLSEFDPLTGQIVKRIA
RTTVYPKTHYVTPREKILEATELIKQELRERKQYLLDNNKLIEAQRIHERVQYDIEMMVE
LGYCSGIENYSRYLSGRAPGEGPPTLLDYLPADGLLVIDESHVTVPQIGAMYKGDRSRKT
TLVEYGFRLPSALDNRPLKFEEFEQLMPQTIYVSATPNSYELEKSGGEIVEQVVRPTGLL
DPELEVRPVGIQVDDLLSEVAKRVAVNERVLVTTLTKRMSEDLTEYLDEHGVKVRYLHSD
IDTVERVEIIRDLRLGKFDVLVGINLLREGLDMPEVSLVCILDADKEGFLRSERSLIQTI
GRAARNVNGKVILYADRITNSMAKAIGETERRREKQRLYNLEHGIVPKGVVKRITDVMDV
DDGREAEKGHGQASLGRVAEPKAKRYHADAAQLSHDIDKLEKQMHEHARNLEFEQAAALR
DEVKRLRELLISA