Protein Info for SO2503 in Shewanella oneidensis MR-1

Name: exsB
Annotation: exsB protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF02540: NAD_synthase" amino acids 4 to 64 (61 residues), 22.5 bits, see alignment E=5.8e-09 PF06508: QueC" amino acids 7 to 216 (210 residues), 268.6 bits, see alignment E=3.4e-84 TIGR00364: queuosine biosynthesis protein QueC" amino acids 9 to 209 (201 residues), 267.6 bits, see alignment E=3e-84

Best Hits

Swiss-Prot: 100% identical to QUEC_SHEON: 7-cyano-7-deazaguanine synthase (queC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 100% identity to son:SO_2503)

MetaCyc: 68% identical to 7-cyano-7-deazaguanine synthase (Escherichia coli K-12 substr. MG1655)
RXN-12093 [EC: 6.3.4.20]

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EE85 at UniProt or InterPro

Protein Sequence (238 amino acids)

>SO2503 exsB protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSASVSKVVVVFSGGQDSTTCLIQALTQYDEVHGITFDYGQRHREEIDVAKSLAQRLNIT
SHKVMDVSLLNELAISALTRDAIPVSHELMENGLPNTFVPGRNILFLTLAGIYAYQLGAE
AIITGVCETDFSGYPDCRHDFVRAMESALVQGMDKKLNIITPLMWLNKAQTWALADKYQQ
LDLVRHHTLTCYNGIVGDGCGDCPACHLRQRGLDDYLQNKSAVMASLTQAIETGKPQA