Protein Info for SO2489 in Shewanella oneidensis MR-1

Name: zwf
Annotation: glucose-6-phosphate 1-dehydrogenase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 66% identical to G6PD_DICD3: Glucose-6-phosphate 1-dehydrogenase (zwf) from Dickeya dadantii (strain 3937)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 100% identity to son:SO_2489)

MetaCyc: 65% identical to NADP+-dependent glucose-6-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Glucose-6-phosphate dehydrogenase. [EC: 1.1.1.49]

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

aspartate superpathway (23/25 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
L-lysine biosynthesis I (9/9 steps found)
pentose phosphate pathway (8/8 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
heterolactic fermentation (15/18 steps found)
superpathway of glucose and xylose degradation (14/17 steps found)
Entner-Doudoroff pathway I (8/9 steps found)
L-lysine biosynthesis VI (6/7 steps found)
pentose phosphate pathway (oxidative branch) I (3/3 steps found)
L-lysine biosynthesis II (6/9 steps found)
cytosolic NADPH production (yeast) (3/5 steps found)
superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (5/8 steps found)
formaldehyde oxidation I (3/6 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EE98 at UniProt or InterPro

Protein Sequence (490 amino acids)

>SO2489 glucose-6-phosphate 1-dehydrogenase (NCBI ptt file) (Shewanella oneidensis MR-1)
MGKTTSGAKACDFVLFGTKGDLARRKLLPSLYQLDKAELLDKDTKVIGVAKDEFSQDEYR
DLVILALKTFVKEPLCEDTLNRFVSRCYYVGTNFTESAGYGAFHELLKPEERVMVSYFAT
PPSIFGDICRCLHEQNLIHSDSRVVLEKPIGSDLASSRIINDQVSAYFKESQVYRIDHYL
GKETVQNLIALRFANSLFASKWDNRTIDHVQITVAEEVGIEGRWGYFDKAGQMRDMIQNH
LLQVLTLVAMDPPVNLDADSIRDEKVKVLKSLRPINADNVYENTVRGQYSAGFLKGSPVP
GYLEEEGANVQSHTETFVALRVDIDNWRWAGVPFYLRSGKRMPFKSSEIVVYFKNPPHNL
YRSSYRNLPPNKLTIRLQPHEGVEIQMMNKVPGLEQKQRLQTTKLDLSFSDTFKNERIAD
AYERLLLEAMLGNQALFVRRDEVEQAWTWVDGIIQAWEQSNEKPKPYPAGTWGPVASVAL
ITKDGRSWDE