Protein Info for SO2488 in Shewanella oneidensis MR-1
Name: pgl
Annotation: 6-phosphogluconolactonase (NCBI ptt file)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 39% identical to 6PGL_PSEAE: 6-phosphogluconolactonase (pgl) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K01057, 6-phosphogluconolactonase [EC: 3.1.1.31] (inferred from 100% identity to son:SO_2488)Predicted SEED Role
"6-phosphogluconolactonase (EC 3.1.1.31), eukaryotic type" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 3.1.1.31)
MetaCyc Pathways
- superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
- pentose phosphate pathway (8/8 steps found)
- heterolactic fermentation (15/18 steps found)
- superpathway of glucose and xylose degradation (14/17 steps found)
- Entner-Doudoroff pathway I (8/9 steps found)
- pentose phosphate pathway (oxidative branch) I (3/3 steps found)
- formaldehyde oxidation I (3/6 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Pentose phosphate pathway
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.1.1.31
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8EE99 at UniProt or InterPro
Protein Sequence (232 amino acids)
>SO2488 6-phosphogluconolactonase (NCBI ptt file) (Shewanella oneidensis MR-1) MIKETVFKSFDTPAALEQQLANKIASQLQEAVDARGKASLVVSGGSTPLKLFELLSMKSI DWSDVYITLADERWVDVEDSASNERLVREHLLQNRAANAKFRGLKNMFSTAEAGADMTCE SLSNFPRPFDVVVLGMGNDGHTCSWFPCSAELNDALTTQALCVATNPTTAPHGRITLSKN AILNSRQIYLHLVGEQKLSVYRQALENDDVNAMPIRAVLAQRKTPVDVFWSA