Protein Info for SO2481 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 14 to 40 (27 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 142 to 167 (26 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 262 to 279 (18 residues), see Phobius details amino acids 285 to 300 (16 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 361 to 388 (28 residues), see Phobius details amino acids 396 to 416 (21 residues), see Phobius details amino acids 441 to 459 (19 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 182 to 458 (277 residues), 97.3 bits, see alignment E=5.2e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2481)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEA6 at UniProt or InterPro

Protein Sequence (460 amino acids)

>SO2481 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSEPTALSLIPPVVVLVLAIWLRRPILSLIIGAVTGFLLLDPTQVLNNFARTSLKVMTDE
TIGWLILVCGCFGALIALLVRTGGALAFGRNALKFAKGPRSSLFMTFILGIVIFIDDYLN
ALTVGETMKRVTDKFKVSREMLAYVVDSTAAPVCVLVPLSTWAVFFGGLLVDNGVAAEGQ
GISVYMQAIPYMLYAWLAVAMVLLVSLGIVPAIGPMKKAQLRAANGEPAEAQVDLDQVQT
SDEYAIAAIEEEFKHADNQGKLHNFLVPILLLVGFTVYFDIDVWKGLLATLVITLPYYAV
QRLMPLSEMMDQMIDGFKSMLPAIGTVIAAFVFKDVCDAMLLPQYVIESLSPFMTPQLLP
AVVFLSMAILAFATGSSWGIFAVTIPIVMPLAQSVGADIPLVIGALLSASSFGSQACFYS
DSTVLAAQGSGCNLVSHAVTQLPYALIAAVIAFFGFILIA