Protein Info for SO2476 in Shewanella oneidensis MR-1

Annotation: polysaccharide biosynthesis protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF01053: Cys_Met_Meta_PP" amino acids 28 to 181 (154 residues), 28 bits, see alignment E=2.2e-10 PF01041: DegT_DnrJ_EryC1" amino acids 38 to 335 (298 residues), 294 bits, see alignment E=4.8e-91 PF00155: Aminotran_1_2" amino acids 41 to 157 (117 residues), 32.6 bits, see alignment E=1.3e-11 PF00266: Aminotran_5" amino acids 58 to 313 (256 residues), 28.9 bits, see alignment E=1.5e-10

Best Hits

Swiss-Prot: 100% identical to KDNA_SHEON: 8-amino-3,8-dideoxy-alpha-D-manno-octulosonate transaminase (kdnA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to son:SO_2476)

MetaCyc: 100% identical to 8-amino-3,8-dideoxy-D-manno-octulosonate transaminase (Shewanella oneidensis MR-1)
RXN-16747 [EC: 2.6.1.109]

Predicted SEED Role

"DegT/DnrJ/EryC1/StrS aminotransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.109

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEB1 at UniProt or InterPro

Protein Sequence (395 amino acids)

>SO2476 polysaccharide biosynthesis protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MPGFELFGPEEKQEVADVMEHGFTFRYNFDHMRNDRWKTRDMEQLLCEKMNVKHAHLLSS
GTAALQTAMMAAGIGAGDEVIVPPFTFVASVEAIFMAGAVPIFAEIDETLCLSPEGIEAV
ITPRTKAINLVHMCGSMAKMDEIKAICKKHNLVLLEDACQAIGGSYKGQALGTIGDVGCY
SFDSVKTITCGEGGAVITNNTEIYDNAHMFSDHGHDHIGKDRGAESHPIMGLNFRISEMN
AALGLAQLRKLDTIIDIQRKNKKAIKDAMASIPEVSFREIPDPEGDSAGFLSFMLPTEAR
TQEISKKLAANGVDGCFYWYVNNWHYLKNWKHIQELKAPAALPITLIADRPDYTQISVPK
SDAIMSRTISMLIKLSWTDAQIAERIENIKKAFAQ