Protein Info for SO2473 in Shewanella oneidensis MR-1

Annotation: hydrolase, alpha/beta fold family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF00561: Abhydrolase_1" amino acids 26 to 259 (234 residues), 64.5 bits, see alignment E=2.4e-21 PF12697: Abhydrolase_6" amino acids 32 to 265 (234 residues), 45.8 bits, see alignment E=2.4e-15 PF12146: Hydrolase_4" amino acids 52 to 254 (203 residues), 30.5 bits, see alignment E=4.5e-11 PF03096: Ndr" amino acids 64 to 273 (210 residues), 30 bits, see alignment E=4.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2473)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEB4 at UniProt or InterPro

Protein Sequence (277 amino acids)

>SO2473 hydrolase, alpha/beta fold family (NCBI ptt file) (Shewanella oneidensis MR-1)
MDLSSYRQQISIEGSQLSYLDIGTGPALLFGHSYLWDSAMWAPQIANLCKSYRCIVPDLW
GHGQSAAVPENCHSLLDISEHMLALMDALEIETFSVIGLSVGAMWGAELVLKAPTRVKAL
VMLDSFIGFEPEITRAKYFGMLDMIQTAGSIPPQLISAISPLFFADNAKVNNPELVHGFE
ANLARLAPERIPSIVKLGRIIFGRRDTLEFAEQFTLPCLVMVGVEDKARSVLESYLMSDA
IDGSQLVHIPNAGHISSLEQAEFVTDRLRQFLSQVSY