Protein Info for SO2458 in Shewanella oneidensis MR-1

Annotation: transporter, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 103 to 119 (17 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 336 to 359 (24 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details amino acids 434 to 456 (23 residues), see Phobius details amino acids 467 to 494 (28 residues), see Phobius details amino acids 500 to 520 (21 residues), see Phobius details PF07690: MFS_1" amino acids 37 to 483 (447 residues), 89.9 bits, see alignment E=1.6e-29 PF13347: MFS_2" amino acids 74 to 276 (203 residues), 41 bits, see alignment E=9.4e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2458)

Predicted SEED Role

"Predicted maltose transporter MalT" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEC4 at UniProt or InterPro

Protein Sequence (529 amino acids)

>SO2458 transporter, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MSADHTVTQLDSFSATTHSHATHSVQPELNFWQIFNMCFGFLGIQFGFALQNANVSRIFQ
TLGASIDEIPILWIAAPLTGLLVQPIIGYLSDNTWGCLGRRRPYFLIGAILTTLAIFVMP
HSPTLWIAAGMLWIMDASINIAMEPFRAFVGDNLPPSQRTQGYAMQSFFIGIGAVVASAL
PYILSNFFNVANTAPAGEIADSVRYAFYFGGTVLFLAVTWTVISTKEYSPEELAAFHAKT
KTDVEEQCKRSRTHKDYQFASFVWMGLGALLTFTVWAQDLDKQLYILSIGIFAFGPLQLY
CALRLSQSQPSQRAQLGMVFNVVDDLFHMPKAMHQLAIVQFFSWFALFAMWIYTTSAVTS
YHFGSSDVLSQAYNDGADWVGVLFASYNGFSAIAALFIPLLAKRIGIKLTHTFNMFCGGF
GLISFYFIKDPNLLWLAMIGVGIAWASILSIPYAILSGTLPPKKMGVYMGIFNFFIVIPQ
LLAASVLGLILNGLFDGQPIYALITGGVFMLCAGIAVLFVEQPKALTPH