Protein Info for SO2447 in Shewanella oneidensis MR-1

Annotation: channel protein, hemolysin III family subfamily (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 49 to 72 (24 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details PF03006: HlyIII" amino acids 13 to 209 (197 residues), 128.1 bits, see alignment E=2.1e-41 TIGR01065: channel protein, hemolysin III family" amino acids 16 to 215 (200 residues), 213.9 bits, see alignment E=8.7e-68

Best Hits

Swiss-Prot: 55% identical to YQFA_SHIFL: UPF0073 inner membrane protein YqfA (yqfA) from Shigella flexneri

KEGG orthology group: K11068, hemolysin III (inferred from 100% identity to son:SO_2447)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EED5 at UniProt or InterPro

Protein Sequence (217 amino acids)

>SO2447 channel protein, hemolysin III family subfamily (NCBI ptt file) (Shewanella oneidensis MR-1)
MHQEKPLNISAYSLSEEIANSISHGLGVIAGAVGLIFMLLKGVDHLSSIQLTGVIIYGAS
LILLFLSSTLYHSVTHRGWKHKLKIVDHCAIYCLIAGTYTPLMLISLQGNLSTIILTAIW
SLAIGGILFKTLFIHRFKKLSLVLYLAMGWLCMTVIGDLTAAMSPLGFNLLLLGGLFYTL
GVIFYVGKRIPYNHAIWHLFVLAGAMSHFFCIYLTVI