Protein Info for SO2418 in Shewanella oneidensis MR-1

Annotation: ISSod5, transposase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF00872: Transposase_mut" amino acids 11 to 374 (364 residues), 312.5 bits, see alignment E=1.9e-97

Best Hits

Swiss-Prot: 41% identical to TRA3_RHIME: Transposase for insertion sequence element ISRM3 (R00164) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to son:SO_2418)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEG4 at UniProt or InterPro

Protein Sequence (401 amino acids)

>SO2418 ISSod5, transposase (NCBI ptt file) (Shewanella oneidensis MR-1)
MTTPTFDINAAIQALREGKDLTGKDGILTPLIKQLTEAALAAELDSHLTSTEGANRKNGK
TTKTIKSPLGNFELNTPRDRAGTFEPQLVKKHQTQLTDEMERKIIGLFSLGSSYQDIRAH
IEDMYGMSVSNGTVNAITDKLLPELQAWRERELEPLYPVIWLDAIHYKIKENGRFISKAV
YTILALNVDGKKELLGLYLSDNEGAHHWLSVLTDLYNRGVKDILIACVDGLKGFPEAIAT
IYPQTEVQLCVIHQIRNSIKYVASKHQKAFMADLKCVYKAATLNAAEMALDELETKWGDK
YPVVIKSWRNKWALLSVYFKYPDYVRTAIYTTNAVEAVHRQFRKLAKTKGGFANENSLLK
LLYAGILKASERWTHPIQNWNLTLSQLSIHFEGRLENHIDL