Protein Info for SO2414 in Shewanella oneidensis MR-1

Annotation: phosphoglycolate phosphatase, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF00702: Hydrolase" amino acids 6 to 182 (177 residues), 84.6 bits, see alignment E=2.5e-27 PF13419: HAD_2" amino acids 9 to 183 (175 residues), 100.3 bits, see alignment E=2.6e-32 PF12710: HAD" amino acids 9 to 177 (169 residues), 27.3 bits, see alignment E=9.4e-10 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 102 to 182 (81 residues), 27.8 bits, see alignment E=3.1e-10

Best Hits

Swiss-Prot: 39% identical to GPH_XANC8: Phosphoglycolate phosphatase (XC_1847) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to son:SO_2414)

MetaCyc: 35% identical to N-acetyl-beta-muramate 6-phosphate phosphatase (Pseudomonas putida KT2440)
RXN-18659 [EC: 3.1.3.105]

Predicted SEED Role

"Similar to phosphoglycolate phosphatase, clustered with ubiquinone biosynthesis SAM-dependent O-methyltransferase" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.105 or 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEG8 at UniProt or InterPro

Protein Sequence (229 amino acids)

>SO2414 phosphoglycolate phosphatase, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MSLSEIKGVLFDLDGTLADTAPDLVEALNLSLRDVGIAAKPLAAMRSAASHGSFALVDAA
IPDADETLRTQVQQGLLIHYQRINGEHCQLFAGIAPLLDWLELHSVPFGVITNKPARFTR
PLLNKLKLTARMSVVISGDSTRYAKPHTAPMLLGAQQLQCKPHQILYLGDAERDLLAAQA
AGMLGGVALWGYLSATDTPSTWPAYAHYPSPLCLHTALSQALAKISQQN