Protein Info for SO2410 in Shewanella oneidensis MR-1

Name: serC
Annotation: phosphoserine aminotransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to SERC_SHEON: Phosphoserine aminotransferase (serC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00831, phosphoserine aminotransferase [EC: 2.6.1.52] (inferred from 100% identity to son:SO_2410)

Predicted SEED Role

"Phosphoserine aminotransferase (EC 2.6.1.52)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 2.6.1.52)

MetaCyc Pathways

superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
L-serine biosynthesis I (3/3 steps found)
L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)
superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEH2 at UniProt or InterPro

Protein Sequence (367 amino acids)

>SO2410 phosphoserine aminotransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MAVSAIYNFCAGPAMLPAAVMKKAQQELLDWNGLGVSVMEVSHRGKEFIALTKQAEADLR
ELMHIPQNYHVLFMHGGGRGQFSAVVNNFLGNQGRALYLVSGQWSSAALAEAQKLAGDAQ
IDSLNIVEKHNCLNAVVLPDLHKIDADYRYVHYCPNETVDGIEIFDELDSPWPIVADLSS
TIMSREIDVSRYGLIYAGAQKNIGPSGLSIVIVRDDMLTLPSLPQSSIMDYRLAVEHDSM
FNTPPTFAWYLAAEVFAWLKSIGGVASIAKINQQKAQMLYACIDANPFYKNGVVAANRSQ
MNVTFQLADESLDGAFLKEAEAVGLVALKGHRIVGGMRASLYNAMPLEGVAALVTFMNEF
AAKHYNI