Protein Info for SO2408 in Shewanella oneidensis MR-1

Annotation: radical activating enzyme (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR04041: glycine radical enzyme activase, YjjW family" amino acids 1 to 281 (281 residues), 400.3 bits, see alignment E=2.2e-124 PF13353: Fer4_12" amino acids 11 to 172 (162 residues), 47.9 bits, see alignment E=6.9e-16 PF04055: Radical_SAM" amino acids 21 to 220 (200 residues), 43.3 bits, see alignment E=1.9e-14 PF14697: Fer4_21" amino acids 41 to 86 (46 residues), 35.1 bits, see alignment 4.8e-12 PF13187: Fer4_9" amino acids 41 to 88 (48 residues), 30.9 bits, see alignment 9e-11 PF12838: Fer4_7" amino acids 41 to 88 (48 residues), 37 bits, see alignment 1.5e-12 PF00037: Fer4" amino acids 68 to 88 (21 residues), 21.2 bits, see alignment (E = 7.8e-08)

Best Hits

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 100% identity to son:SO_2408)

Predicted SEED Role

"radical activating enzyme"

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEH4 at UniProt or InterPro

Protein Sequence (286 amino acids)

>SO2408 radical activating enzyme (NCBI ptt file) (Shewanella oneidensis MR-1)
MVSQLLPFSCVDGPGSRLVLFLQGCNYQCKNCHNPHTIGLCDGCGDCIATCPDKALTLIN
ANNKHQTHWDKDRCSQCDTCLAVCPQQANPKVTRYTVEEILAILHHQRHFINGITVSGGE
ASLQLPFIIELFKAIKASTSLSQLTCMLDTNGSLSLTGWHKLLPFLDGAMVDLKAWQRDT
HRYITGRDNHAVFKSIELLAQQQKLYEVRLLHIPGITDFEQEIDALSCYLLTLGADTRVK
LNAFHHHGVVDEALTWPSCTQTDIEALAASLAQRGLTNIVLPSIYL