Protein Info for SO2407 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 TIGR04040: glycine radical enzyme, YjjI family" amino acids 6 to 507 (502 residues), 751.8 bits, see alignment E=1.5e-230 PF11230: YjjI-like" amino acids 16 to 507 (492 residues), 724.1 bits, see alignment E=3.3e-222

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2407)

Predicted SEED Role

"FIG01059348: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEH5 at UniProt or InterPro

Protein Sequence (519 amino acids)

>SO2407 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLLQDKLVQIVTNPQLSPKQKSNYLALEAEASLPYMPISTEVNAAMNDGVICDMFEGHTP
FKPRYVLPDYARYLQQGSEYLELSPAQDLDEALNALTILYHHVPSVTNIPVYLGQLDDIL
MPFVEGMDADALYRKLKLFWIMLDRTLPDAFMHVNLGPTDNIVCRTLLRIDAELKQVAPN
LTFMYDPAVTPDELLQIATTNICQCSKPHIANYPQHASAFDACGFGIVSCYNALPLAGGA
NTLVRLNLKEVALKATSINDFFERVLPYYCSLTFELIEARSAFLHQESHFFDSFLVKEQL
IDESRFAPMFGIYGMAEAVNILQAQMTSETDKSSQSNKPTGYGHSMDANQLGYRISAALD
TIVKSTPVTYGYHGRALLHSQGGISLDKGVTPGVRIPYGTEPNPIAHIQALAQHHQYYTA
GISDILTIDETVKSNPQAMFQLCKAALELGFREFTANVASNDLMRVTGYMVKRSDIEAFK
QCGSRLNTTGLGAEAAQNTGILQRQARVIAHEHSPCVVK