Protein Info for SO2397 in Shewanella oneidensis MR-1

Annotation: oxidoreductase, short-chain dehydrogenase/reductase family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details PF00106: adh_short" amino acids 12 to 199 (188 residues), 135.7 bits, see alignment E=2.9e-43 PF23441: SDR" amino acids 13 to 195 (183 residues), 42.7 bits, see alignment E=9.3e-15 PF08659: KR" amino acids 14 to 174 (161 residues), 27.5 bits, see alignment E=5.6e-10 PF13561: adh_short_C2" amino acids 20 to 255 (236 residues), 184.4 bits, see alignment E=5.5e-58

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2397)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEI5 at UniProt or InterPro

Protein Sequence (275 amino acids)

>SO2397 oxidoreductase, short-chain dehydrogenase/reductase family (NCBI ptt file) (Shewanella oneidensis MR-1)
MLNTTMFNYQGKNVVVVGGTSGINLAIAIAFAHAGANVAVASRSQDKVDAAVLQLKQAHP
EGIHLGVSFDVRDLVAVEQGFEAIASEFGFIDVLVSGAAGNFPATAAKLTANGFKAVMDI
DLLGSFQVLKTAYPLLRRPQGNIIQISAPQASIAMPMQAHVCAAKAGVDMLTRTLAIEWG
CEGIRINSIIPGPITGTEGFNRLAPSVVLQQQVAQSVPLKRNGEGQDIANAALFLGSELA
SYITGVVLPVDGGWSLGGASIAMTALGELAAKGSN