Protein Info for SO2373 in Shewanella oneidensis MR-1

Annotation: drug resistance transporter, Bcr/CflA family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 215 to 238 (24 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 349 to 366 (18 residues), see Phobius details amino acids 372 to 390 (19 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 14 to 389 (376 residues), 287.9 bits, see alignment E=8e-90 PF07690: MFS_1" amino acids 20 to 351 (332 residues), 142.2 bits, see alignment E=2e-45 PF00083: Sugar_tr" amino acids 34 to 191 (158 residues), 27.8 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2373)

Predicted SEED Role

"Multidrug resistance transporter, Bcr/CflA family" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EEK8 at UniProt or InterPro

Protein Sequence (423 amino acids)

>SO2373 drug resistance transporter, Bcr/CflA family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKTSSNIFVNMKFFIFLLYLALLSMLGFIATDMYLPAFKAIESSLNSSPSQVAMSLTCFL
AGLALGQLIYGPLVSKLGKRYALLIGLAVFALSSVAIANSDSVMMLNIARFFQAIGACSA
GVIWQAIVVEQYDAEKAQGIFSNIMPLVALSPALAPILGAYILNEFGWRAIFISLCVIAF
LLVLMTLYFVPGKSKHQDIKPSAVSYGQILKNTRYLGNVVIFGACSGAFFAYLTVWPIVM
EQHGYQATEIGLSFIPQTIMFIVGGYASKLLIKRIGADKTLNVLLSIFGICVVSIVLFTL
LFKTITIFPLLISFSILAAANGAIYPIVVNSALQQFTQHASKAAGLQNFLQITIAFGASS
LVAMWANFGEVAIGWGILCCSLLVILGYVLKTEQTWGDFAHHFTAPDPARVGIVANAKQN
QAD